Structure of PDB 8q7n Chain M Binding Site BS01

Receptor Information
>8q7n Chain M (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFI
VMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSV
TIKEGSQLKQQIQSIQQSIERLLV
Ligand information
>8q7n Chain 6 (length=78) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugaca
<<<<<.<<....>>>>>>>...............................
............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q111 Q114 Q115
Binding residue
(residue number reindexed from 1)		Q107 Q110 Q111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030515 snoRNA binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0034511 U3 snoRNA binding
GO:0034512 box C/D sno(s)RNA binding
GO:0051117 ATPase binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000492 box C/D snoRNP assembly
GO:0006397 mRNA processing
GO:0007338 single fertilization
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0001651 dense fibrillar component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005690 U4atac snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
PDBsum8q7n
PubMed38383864
UniProtP55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)

[Back to BioLiP]