Structure of PDB 8q72 Chain M Binding Site BS01

Receptor Information
>8q72 Chain M (length=117) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYSPDELREKLARQWDSAKLRAERLLSPGNWPLCLPIGKPSTKIFAEQTQ
RVLQHVQRWRQVAVGHVEWEAVSFRASDTPVLMPLRWILNSPSEWINAAA
DPVVSREFRLLEGIIEQ
Ligand information
>8q72 Chain R (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatatatatatatatatatatatatatatatatatatat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q72 Structural basis for plasmid restriction by SMC JET nuclease.
Resolution4.17 Å
Binding residue
(original residue number in PDB)		Y2 K39
Binding residue
(residue number reindexed from 1)		Y2 K39
Enzymatic activity
Enzyme Commision number ?
External links