Structure of PDB 8pm5 Chain M Binding Site BS01

Receptor Information
>8pm5 Chain M (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWK
R
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pm5 transcription factor BARHL2 bound to DNA sequences
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y256 R262 K277 Q281 R284 K288
Binding residue
(residue number reindexed from 1)		Y18 R24 K39 Q43 R46 K50
External links
PDB RCSB:8pm5, PDBe:8pm5, PDBj:8pm5
PDBsum8pm5
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]