Structure of PDB 8f7q Chain M Binding Site BS01

Receptor Information
>8f7q Chain M (length=287) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALA
DALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIWTLCTMSV
DRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQG
SIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVR
MLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTF
QTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREF
Ligand information
>8f7q Chain Q (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YGGFMTSEKSQTPLVTLFKNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f7q Structures of the entire human opioid receptor family.
Resolution3.22 Å
Binding residue
(original residue number in PDB)		A70 I71 N129 L131 G133 I146 Y150 M153 D218 C219 V238 W320 I324 Y328
Binding residue
(residue number reindexed from 1)		A5 I6 N64 L66 G68 I81 Y85 M88 D153 C154 V173 W255 I259 Y263
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0004930 G protein-coupled receptor activity
GO:0004979 beta-endorphin receptor activity
GO:0004985 G protein-coupled opioid receptor activity
GO:0005245 voltage-gated calcium channel activity
GO:0005515 protein binding
GO:0031681 G-protein beta-subunit binding
GO:0038047 morphine receptor activity
GO:0042923 neuropeptide binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007197 adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007600 sensory perception
GO:0008285 negative regulation of cell population proliferation
GO:0019233 sensory perception of pain
GO:0038003 G protein-coupled opioid receptor signaling pathway
GO:0048149 behavioral response to ethanol
GO:0050769 positive regulation of neurogenesis
GO:0061358 negative regulation of Wnt protein secretion
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070588 calcium ion transmembrane transport
GO:0071315 cellular response to morphine
GO:0080135 regulation of cellular response to stress
GO:2000310 regulation of NMDA receptor activity
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043204 perikaryon
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8f7q, PDBe:8f7q, PDBj:8f7q
PDBsum8f7q
PubMed36638794
UniProtP35372|OPRM_HUMAN Mu-type opioid receptor (Gene Name=OPRM1)

[Back to BioLiP]