Structure of PDB 8ejl Chain M Binding Site BS01

Receptor Information
>8ejl Chain M (length=120) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQ
AAMQMLKETINEEAAEWDRLHREPRGSDIAGTTSTLQEQIGWMTHNPPIP
VGEIYKRWIILGLNKIVRMY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ejl A molecular switch modulates assembly and host factor binding of the HIV-1 capsid.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		N53 N57 M66 N74 S102 T107 T108
Binding residue
(residue number reindexed from 1)		N40 N44 M53 N61 S77 T82 T83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Biological Process
External links
PDB RCSB:8ejl, PDBe:8ejl, PDBj:8ejl
PDBsum8ejl
PubMed36759579
UniProtP12493|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]