Structure of PDB 8d9w Chain M Binding Site BS01

Receptor Information

>8d9w Chain M (length=301) Species: 10090 (Mus musculus)

SASAVYVICRNYRGDVVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVV
QVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQE
APRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIV
GSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLS
RFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIEQFKRRSTANNVEIHI
GGKISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRT
Q

Ligand information

>8d9w Chain Y (length=18) Species: 9606 (Homo sapiens)

DRKGGSYSQAAGSDSAQS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8d9w Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat.
• Resolution: 9.3 Å
• Binding residue (original residue number in PDB): P383 Y394 L395 K396 P407 W408 V409 Y411
• Binding residue (residue number reindexed from 1): P261 Y272 L273 K274 P285 W286 V287 Y289

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0006886 intracellular protein transport
• GO:0015031 protein transport
• GO:0016192 vesicle-mediated transport
• GO:0032438 melanosome organization
• GO:0035646 endosome to melanosome transport
• GO:0060155 platelet dense granule organization
• GO:1903232 melanosome assembly

Cellular Component

• GO:0005765 lysosomal membrane
• GO:0005769 early endosome
• GO:0005794 Golgi apparatus
• GO:0005802 trans-Golgi network
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0030121 AP-1 adaptor complex
• GO:0030131 clathrin adaptor complex
• GO:0030665 clathrin-coated vesicle membrane
• GO:0031410 cytoplasmic vesicle
• GO:0032588 trans-Golgi network membrane
• GO:0043231 intracellular membrane-bounded organelle
• GO:0045202 synapse

External links

• PDB: RCSB:8d9w, PDBe:8d9w, PDBj:8d9w
• PDBsum: 8d9w
• PubMed: 36269825
• UniProt: P35585|AP1M1_MOUSE AP-1 complex subunit mu-1 (Gene Name=Ap1m1)