Structure of PDB 8cen Chain M Binding Site BS01

Receptor Information
>8cen Chain M (length=310) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDRVGEA
SNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAK
ITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRR
AEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSG
AQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSI
YLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANG
VVSLDNLPGV
Ligand information
>8cen Chain T (length=73) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatttttatgtatgtacaacacacatcggaggtgaatcgaacgttccat
agctattatatacacagcgtgct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cen Yeast PIC-Mediator structure with RNA polymerase II C-terminal domain.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K112 G271 K272 T276 T305
Binding residue
(residue number reindexed from 1)		K80 G239 K240 T244 T273
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001139 RNA polymerase II complex recruiting activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006352 DNA-templated transcription initiation
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0010467 gene expression
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070897 transcription preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cen, PDBe:8cen, PDBj:8cen
PDBsum8cen
PubMed37014863
UniProtP29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)

[Back to BioLiP]