Structure of PDB 7vpx Chain M Binding Site BS01

Receptor Information
>7vpx Chain M (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVE
Ligand information
>7vpx Chain L (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacuuaccuggcaggggagauaccaugaucacgaaggugguuuucccag
ggcgaggcuuauccauugcacuccggaugugcugaccccugcgauuuccc
caaaugugggaaacucgacugcauaauuugugguagugggggacugcguu
cgcgcuuuccccug
...........<<<<.<<<<<.<<<<<..........>>>>>>>>>>.<<
<<...<<<.<<<<<..........>>>>>.>>>...>>>>.<<<<<<<<<
.......>>>>>>.>>>.>>>>...............<<<<<<..<<<..
..>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vpx Mechanism for Branch Site Recognition and Proofreading During Prespliceosome Assembly
Resolution3.0 Å
Binding residue
(original residue number in PDB)
Y13 N15 N16 E19 S48 L49 K50 M51 R52 Q54 F56 K80 Q85 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)
Y8 N10 N11 E14 S43 L44 K45 M46 R47 Q49 F51 K75 Q80 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
GO:0042802 identical protein binding
GO:1990446 U1 snRNP binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0030532 small nuclear ribonucleoprotein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7vpx, PDBe:7vpx, PDBj:7vpx
PDBsum7vpx
PubMed38196034
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]