Structure of PDB 7u0i Chain M Binding Site BS01

Receptor Information
>7u0i Chain M (length=75) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNN
Ligand information
>7u0i Chain I (length=149) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acatatcctcagtggtgagtattaacatggaacttactccaacaatacag
atgctgaataaatgtagtctaagtgaaggaagaaggaaaggtgggagctg
ccatcactcagaattgtccagcagggattgtgcaagcttgtgaataaag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u0i Structural mechanism of LIN28B nucleosome targeting by OCT4.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S180 T182 R186 S193 N196
Binding residue
(residue number reindexed from 1)		S41 T43 R47 S54 N57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0015144 carbohydrate transmembrane transporter activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0008643 carbohydrate transport
GO:0055085 transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7u0i, PDBe:7u0i, PDBj:7u0i
PDBsum7u0i
PubMed37327775
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]