Structure of PDB 7nvu Chain M Binding Site BS01

Receptor Information
>7nvu Chain M (length=298) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFTKDPSRVG
DSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAF
KEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIAC
RQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRF
CSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEK
RTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
Ligand information
>7nvu Chain N (length=44) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaggggggctataaaagggggtgggggctctcttccgcatcgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nvu Structures of mammalian RNA polymerase II pre-initiation complexes.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S109 Y146 A155 N156 K189 R193
Binding residue
(residue number reindexed from 1)		S91 Y128 A137 N138 K171 R175
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993 RNA polymerase II complex binding
GO:0003677 DNA binding
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0016407 acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
GO:0046966 nuclear thyroid hormone receptor binding
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0140297 DNA-binding transcription factor binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006338 chromatin remodeling
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006473 protein acetylation
GO:0010467 gene expression
GO:0019083 viral transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0051177 meiotic sister chromatid cohesion
GO:0051225 spindle assembly
GO:0051276 chromosome organization
GO:0070897 transcription preinitiation complex assembly
GO:1904798 positive regulation of core promoter binding
GO:1990114 RNA polymerase II core complex assembly
Cellular Component
GO:0000776 kinetochore
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005694 chromosome
GO:0016604 nuclear body
GO:0032153 cell division site
GO:0032993 protein-DNA complex
GO:0042585 germinal vesicle
GO:0090575 RNA polymerase II transcription regulator complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nvu, PDBe:7nvu, PDBj:7nvu
PDBsum7nvu
PubMed33902107
UniProtQ00403|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]