Structure of PDB 7nt6 Chain M Binding Site BS01

Receptor Information

>7nt6 Chain M (length=366) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IFEEAASFRSYQSKLGRDGRASAATATLTTKIRIFVPATNSPELRWELTL
FALDVIRSPSAAESMKVGAAFTLISMYSERPGALIRSLLNDPDIEAVIID
VGSMVNGIPVMERRGDKAQEEMEGLMRILKTARDSSKGKTPFVDSRAYGL
RITDMSTLVSAVITIEAQIWILIAKAVTAPDTAEESETRRWAKYVQQKRV
NPFFALTQQWLTEMRNLLSQSLSVRKFMVEILIEVKKGGSAKGRAVEIIS
DIGNYVEETGMAGFFATIRFGLETRYPALALNEFQSDLNTIKSLMLLYRE
IGPRAPYMVLLEESIQTKFAPGGYPLLWSFAMGVATTIDRSMGALNINRG
YLEPMYFRLGQKSARH

Ligand information

>7nt6 Chain X (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu

................................................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7nt6 CryoEM structure of the Nipah virus nucleocapsid assembly.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	T181 N257 A265 A347 L348
Binding residue (residue number reindexed from 1)	T178 N254 A262 A344 L345

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005198	structural molecule activity
GO:0005515	protein binding
GO:0060090	molecular adaptor activity

	Biological Process
GO:0039689	negative stranded viral RNA replication
GO:0039697	negative stranded viral RNA transcription

	Cellular Component
GO:0019013	viral nucleocapsid
GO:0019029	helical viral capsid
GO:0030430	host cell cytoplasm
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nt6, PDBe:7nt6, PDBj:7nt6
PDBsum	7nt6
PubMed	34270629
UniProt	Q9IK92\|NCAP_NIPAV Nucleoprotein (Gene Name=N)

[Back to BioLiP]