Structure of PDB 7ml4 Chain M Binding Site BS01

Receptor Information
>7ml4 Chain M (length=234) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSVMDKKDNEVQ
AAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASIL
IGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSQNLTYIPRF
CSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIP
ITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ml4 Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K201 G204 K205
Binding residue
(residue number reindexed from 1)
K124 G127 K128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001139 RNA polymerase II complex recruiting activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006352 DNA-templated transcription initiation
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0010467 gene expression
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070897 transcription preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ml4, PDBe:7ml4, PDBj:7ml4
PDBsum7ml4
PubMed35051353
UniProtP29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)

[Back to BioLiP]