Structure of PDB 7ml0 Chain M Binding Site BS01

Receptor Information
>7ml0 Chain M (length=279) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRT
FNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAK
ITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRR
AEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSQNLTYIPRFCSHLG
LPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAK
VGQTLQVTEGTIKSGYKILYEHRDKLVDP
Ligand information
>7ml0 Chain T (length=66) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atgtacaaacacacatcaaaggtttatagatacattgaaacttttatata
cgcgcctttttttttt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ml0 Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K164 K272 T305
Binding residue
(residue number reindexed from 1)		K132 K225 T258
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001139 RNA polymerase II complex recruiting activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006352 DNA-templated transcription initiation
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0010467 gene expression
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070897 transcription preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ml0, PDBe:7ml0, PDBj:7ml0
PDBsum7ml0
PubMed35051353
UniProtP29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)

[Back to BioLiP]