Structure of PDB 7md5 Chain M Binding Site BS01

Receptor Information
>7md5 Chain M (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAAKELEESSFRKTFEDYLHNVVFVPSPSR
Ligand information
>7md5 Chain O (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7md5 Functionally selective signaling and broad metabolic benefits by novel insulin receptor partial agonists.
Resolution5.2 Å
Binding residue
(original residue number in PDB)		D707 H710 F714 V715 S717 P718 R720
Binding residue
(residue number reindexed from 1)		D17 H20 F24 V25 S27 P28 R30
Enzymatic activity
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
External links
PDB RCSB:7md5, PDBe:7md5, PDBj:7md5
PDBsum7md5
PubMed35177603
UniProtP06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)

[Back to BioLiP]