Structure of PDB 7m5c Chain M Binding Site BS01

Receptor Information
>7m5c Chain M (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEQVAQDTEEVFRSYVFYRHQQEQADPEMVTSTMGQVGRQLAIIGDDIN
RRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGY
RLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAALNLCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5c Structural basis of BAK activation in mitochondrial apoptosis initiation.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		I85 R88 Y89 E92 F93 M96 H99 I114 L118 N124 G126 R127 F134 L183 N185
Binding residue
(residue number reindexed from 1)		I49 R52 Y53 E56 F57 M60 H63 I78 L82 N88 G90 R91 F98 L147 N149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7m5c, PDBe:7m5c, PDBj:7m5c
PDBsum7m5c
PubMed35017502
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]