Structure of PDB 7k7g Chain M Binding Site BS01

Receptor Information
>7k7g Chain M (length=43) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQLKSKHPCSVCTRRKVKCDRMIPCGNCRKRGQDSECMKSTKL
Ligand information
>7k7g Chain I (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacgcgctgtcccccgcgttttaatattagtgtatttgatttccgaa
agttaaaaaagaaatagtaagaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		K11 H12 P13 K21 V22 K23 C24
Binding residue
(residue number reindexed from 1)		K6 H7 P8 K16 V17 K18 C19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP40969|CBF3B_YEAST Centromere DNA-binding protein complex CBF3 subunit B (Gene Name=CEP3)

[Back to BioLiP]