Structure of PDB 6vme Chain M Binding Site BS01

Receptor Information
>6vme Chain M (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAH
MRRVKIEKLQEMVLK
Ligand information
>6vme Chain R (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNASSLYGISAMDGVPFTLHP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vme A helical assembly of human ESCRT-I scaffolds reverse-topology membrane scission.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		K158 M162
Binding residue
(residue number reindexed from 1)		K58 M62
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6vme, PDBe:6vme, PDBj:6vme
PDBsum6vme
PubMed32424346
UniProtQ9H9H4|VP37B_HUMAN Vacuolar protein sorting-associated protein 37B (Gene Name=VPS37B)

[Back to BioLiP]