Structure of PDB 6t9l Chain M Binding Site BS01

Receptor Information

>6t9l Chain M (length=90) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGS
LDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSR

Ligand information

InChI=1S/Zn/q+2

PTFCDOFLOPIGGS-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Zn++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Zn+2]

Formula

Zn

Name

ZINC ION

PDB chain

6t9l Chain M Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t9l Structure of the transcription coactivator SAGA.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	N75 C76
Binding residue (residue number reindexed from 1)	N70 C71
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0000124	SAGA complex
GO:0005634	nucleus
GO:0046695	SLIK (SAGA-like) complex
GO:0070461	SAGA-type complex
GO:0071819	DUBm complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t9l, PDBe:6t9l, PDBj:6t9l
PDBsum	6t9l
PubMed	31969703
UniProt	Q03067\|SGF11_YEAST SAGA-associated factor 11 (Gene Name=SGF11)

[Back to BioLiP]