Structure of PDB 6rdu Chain M Binding Site BS01

Receptor Information

>6rdu Chain M (length=217) Species: 37502 (Polytomella sp. Pringsheim 198.80)

SSVRDVKTGSLPTNFLTGVYRFWRSQNPAEKPHDPVNDRLLPAVVDASDK
RASIGTWATTFFCTIISCNLLGLMPFNEAPTSGLGFATGLGVSVWATATI
LGLSKTGFKFPFIFVPLETISYTFRAVSLGVRLWVNMLAGHTLLHILTGM
ALALPFSLGFFSMVPATFGVCCLLSALVGLEYLVAVLQSGVFSILSTVYV
GEFNHDKFIGPAAKIVK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6rdu Chain M Residue 600

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6rdu Rotary substates of mitochondrial ATP synthase reveal the basis of flexible F 1 -F o coupling.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): H248 H252
• Binding residue (residue number reindexed from 1): H141 H145
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0015078 proton transmembrane transporter activity
• GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Biological Process

• GO:0006754 ATP biosynthetic process
• GO:0015986 proton motive force-driven ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0045259 proton-transporting ATP synthase complex
• GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

External links

• PDB: RCSB:6rdu, PDBe:6rdu, PDBj:6rdu
• PDBsum: 6rdu
• PubMed: 31221832
• UniProt: H8PGG3