Structure of PDB 6id1 Chain M Binding Site BS01

Receptor Information
>6id1 Chain M (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPT
SNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINE
RNAKFNKKAERFYGKYTAEIKQNLERGTAV
Ligand information
>6id1 Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6id1 Structures of the human spliceosomes before and after release of the ligated exon.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		N119 P120 D121 Y127 A130 R133 Q134 K192 R193 Y196 R214
Binding residue
(residue number reindexed from 1)		N6 P7 D8 Y14 A17 R20 Q21 K79 R80 Y83 R101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0001701 in utero embryonic development
GO:0006397 mRNA processing
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0007369 gastrulation
GO:0008284 positive regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0048568 embryonic organ development
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6id1, PDBe:6id1, PDBj:6id1
PDBsum6id1
PubMed30728453
UniProtO95926|SYF2_HUMAN Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)

[Back to BioLiP]