Structure of PDB 6h68 Chain M Binding Site BS01

Receptor Information
>6h68 Chain M (length=396) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGEN
ERLEYEGYTDSSSQASNQYVVGLFNPEKKSIQLYKAPVLVSKVVSKSSKN
LRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDS
AIDIVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESI
IPKKELQFIRVSSILKEADKEKKLELFPYQNNSKYVAKKLDSLTQPSQMT
KLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKP
GQFGRSKDRSYFIDPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKP
SKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVPFKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h68 Structural basis of RNA polymerase I stalling at UV light-induced DNA damage.
Resolution4.6 Å
Binding residue
(original residue number in PDB)		K372 G373
Binding residue
(residue number reindexed from 1)		K365 G366
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0003677 DNA binding
GO:0016779 nucleotidyltransferase activity
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006362 transcription elongation by RNA polymerase I
GO:0006363 termination of RNA polymerase I transcription
GO:0008361 regulation of cell size
GO:0042254 ribosome biogenesis
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h68, PDBe:6h68, PDBj:6h68
PDBsum6h68
PubMed30127008
UniProtQ01080|RPA49_YEAST DNA-directed RNA polymerase I subunit RPA49 (Gene Name=RPA49)

[Back to BioLiP]