Structure of PDB 6gyk Chain M Binding Site BS01

Receptor Information
>6gyk Chain M (length=279) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRT
FNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAK
ITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRR
AEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSQNLTYIPRFCSHLG
LPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAK
VGQTLQVTEGTIKSGYKILYEHRDKLVDP
Ligand information
>6gyk Chain T (length=56) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gctaataccgtggccgggagtggcacacacctatatatatgtggctgggc
cgggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gyk Promoter Distortion and Opening in the RNA Polymerase II Cleft.
Resolution5.1 Å
Binding residue
(original residue number in PDB)		K272 T305 T308
Binding residue
(residue number reindexed from 1)		K225 T258 T261
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001139 RNA polymerase II complex recruiting activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006352 DNA-templated transcription initiation
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0010467 gene expression
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070897 transcription preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gyk, PDBe:6gyk, PDBj:6gyk
PDBsum6gyk
PubMed30472190
UniProtP29055|TF2B_YEAST Transcription initiation factor IIB (Gene Name=SUA7)

[Back to BioLiP]