Structure of PDB 6fy0 Chain M Binding Site BS01

Receptor Information
>6fy0 Chain M (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YELTQPPSVSVAPGTTATITCGGVDIGSTLVHWYQQRPGQAPLLVIYDDS
DRPSGIPERFSGSNSGNMATLTISRVEAGDEADYYCQVWHSTSAVIFGGG
TKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKA
DSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS
TVEKTVAP
Ligand information
>6fy0 Chain A (length=17) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RDKKQKAYALFYRPDVV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fy0 V2-Directed Vaccine-like Antibodies from HIV-1 Infection Identify an Additional K169-Binding Light Chain Motif with Broad ADCC Activity.
Resolution2.57 Å
Binding residue
(original residue number in PDB)
G29 S30 T31 L32 W91 H92
Binding residue
(residue number reindexed from 1)
G27 S28 T29 L30 W89 H90
External links