Structure of PDB 6es3 Chain M Binding Site BS01

Receptor Information

>6es3 Chain M (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIW
FQNRRAKERKINKKKLQQQQQQ

Ligand information

>6es3 Chain B (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgtgttttacgacctcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6es3 Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
Resolution	2.57 Å
Binding residue (original residue number in PDB)	T185 R190 V191 Y193 R198 R228 Q229 N236 K240
Binding residue (residue number reindexed from 1)	T2 R7 V8 Y10 R15 R45 Q46 N53 K57
Binding affinity	PDBbind-CN: Kd=31.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6es3, PDBe:6es3, PDBj:6es3
PDBsum	6es3
PubMed	29638214
UniProt	Q99626\|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]