Structure of PDB 6db7 Chain M Binding Site BS01

Receptor Information
>6db7 Chain M (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YELTQPPSVSVSPGQTARITCSGDALPKEYAYWYQQKSGQAPVLVIYEDT
RRPSGIPERFSGSSSGTMATLTVSGAHVDDEADYYCYSRDTSANQWVFGG
GTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWK
ADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEG
STVEKTVAPT
Ligand information
>6db7 Chain Q (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKRIHIGPGRAFY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6db7 Structural Comparison of Human Anti-HIV-1 gp120 V3 Monoclonal Antibodies of the Same Gene Usage Induced by Vaccination and Chronic Infection.
Resolution2.213 Å
Binding residue
(original residue number in PDB)		K30 E31 Y32 D51 R91
Binding residue
(residue number reindexed from 1)		K28 E29 Y30 D49 R89
External links