Structure of PDB 6ceb Chain M Binding Site BS01

Receptor Information
>6ceb Chain M (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QILKELEESSFRKTFEDYLHNVVFVPRPSR
Ligand information
>6ceb Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ceb Structure of the insulin receptor-insulin complex by single-particle cryo-EM analysis.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		D707 H710 F714 V715 P718 R720
Binding residue
(residue number reindexed from 1)		D17 H20 F24 V25 P28 R30
Enzymatic activity
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
External links
PDB RCSB:6ceb, PDBe:6ceb, PDBj:6ceb
PDBsum6ceb
PubMed29512653
UniProtP06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)

[Back to BioLiP]