Structure of PDB 6ce9 Chain M Binding Site BS01

Receptor Information
>6ce9 Chain M (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QILKELEESSFRKTFEDYLHNVVFVPRPSR
Ligand information
>6ce9 Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ce9 Structure of the insulin receptor-insulin complex by single-particle cryo-EM analysis.
Resolution4.3 Å
Binding residue
(original residue number in PDB)
D707 H710 N711 F714 V715 P718
Binding residue
(residue number reindexed from 1)
D17 H20 N21 F24 V25 P28
Enzymatic activity
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
External links
PDB RCSB:6ce9, PDBe:6ce9, PDBj:6ce9
PDBsum6ce9
PubMed29512653
UniProtP06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)

[Back to BioLiP]