Structure of PDB 6b2z Chain M Binding Site BS01

Receptor Information
>6b2z Chain M (length=249) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNN
NKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIAN
LISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGT
PLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFML
INLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH
Ligand information
>6b2z Chain T (length=24) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YHFMGKAIPPHQLAIGTLGLLGLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b2z Atomic model for the dimeric FO region of mitochondrial ATP synthase.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
L152 P156
Binding residue
(residue number reindexed from 1)
L152 P156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015078 proton transmembrane transporter activity
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6b2z, PDBe:6b2z, PDBj:6b2z
PDBsum6b2z
PubMed29074581
UniProtP00854|ATP6_YEAST ATP synthase subunit a (Gene Name=ATP6)

[Back to BioLiP]