Structure of PDB 6ah0 Chain M Binding Site BS01

Receptor Information
>6ah0 Chain M (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEF
IVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACS
VTIKEGSQLKQQIQSIQQSIERLLV
Ligand information
>6ah0 Chain I (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaaucguagccaaugaggucuauccgaggcgcgau
ugcuaauugccgccgugacgacuugcaauauagucggcacuggcaauuuu
ugacagucucgagacug
..................<<<<.<<<.....<<.....>>..>>>>>>>.
...........<<<<<<.<<<<<........>>>>>.>>>.>>>......
...<<<<<<<>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ah0 Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
Resolution5.7 Å
Binding residue
(original residue number in PDB)		K37 G38 N40 E61 P98 I100
Binding residue
(residue number reindexed from 1)		K34 G35 N37 E58 P95 I97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030515 snoRNA binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0034511 U3 snoRNA binding
GO:0034512 box C/D sno(s)RNA binding
GO:0051117 ATPase binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000492 box C/D snoRNP assembly
GO:0006397 mRNA processing
GO:0007338 single fertilization
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0001651 dense fibrillar component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005690 U4atac snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ah0, PDBe:6ah0, PDBj:6ah0
PDBsum6ah0
PubMed30315277
UniProtP55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)

[Back to BioLiP]