Structure of PDB 5z58 Chain M Binding Site BS01

Receptor Information

ATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDY

Ligand information

ggccuccgaacgguaagagccuagcauguagaacugguuaccuaugaugu
cauacuuauccugucccuuuuuuuucc

..................................................
...........................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	5z58 Structure of the human activated spliceosome in three conformational states.
Resolution	4.9 Å
Binding residue (original residue number in PDB)	I201 C202 K203 F213 C217 F219
Binding residue (residue number reindexed from 1)	I11 C12 K13 F23 C27 F29

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0016740	transferase activity
GO:0046872	metal ion binding
GO:0061630	ubiquitin protein ligase activity

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006281	DNA repair
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0016567	protein ubiquitination
GO:0034247	snoRNA splicing
GO:0070100	negative regulation of chemokine-mediated signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0016607	nuclear speck
GO:0071005	U2-type precatalytic spliceosome

External links

PDB	RCSB:5z58, PDBe:5z58, PDBj:5z58
PDBsum	5z58
PubMed	29360106
UniProt	O15541\|R113A_HUMAN E3 ubiquitin-protein ligase RNF113A (Gene Name=RNF113A)