Structure of PDB 5ylz Chain M Binding Site BS01

Receptor Information

>5ylz Chain M (length=185) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DEINEPPPNICEQCLGDEANIRMTKIPQGSECKICTLPFTLYHFKTSKRS
NNIIKTLICVRCATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTE
EAKNDMMKRFLSLKNVKLGGAQITTKSFFLYNIDASIPEWKITDTVSQLL
SLIVNHKAKCGGLRFQSSELGERFVSIFIIPWSSG

Ligand information

>5ylz Chain D (length=103) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua

<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ylz Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
Resolution	3.6 Å
Binding residue (original residue number in PDB)	I28 H45 K47 R51 N53 M108
Binding residue (residue number reindexed from 1)	I26 H43 K45 R49 N51 M106

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0017070	U6 snRNA binding
GO:0036002	pre-mRNA binding

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0000974	Prp19 complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0071006	U2-type catalytic step 1 spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ylz, PDBe:5ylz, PDBj:5ylz
PDBsum	5ylz
PubMed	29153833
UniProt	P38241\|SLT11_YEAST Pre-mRNA-splicing factor SLT11 (Gene Name=ECM2)

[Back to BioLiP]