Structure of PDB 5wnb Chain M Binding Site BS01

Receptor Information
>5wnb Chain M (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIVLTQSPATLSLSPGERATLSCRASQSVSNHLAWYQQKPGQAPRLLIYE
TSNRATGIPPRFSGSGSGTDFTLTISSLEPEDFAVYYCQQRNNWYTFGQG
TKLEIKRTVAAPSVFIFPPSDEQLKTASVVCLLNNFYPREAKVQWKLQGN
SQESVTEQDSKDSTYSLSSTLTLSKADYKVYACEVTHQGLSSPVTKSFNR
Ligand information
>5wnb Chain A (length=11) Species: 11259 (Human respiratory syncytial virus A2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFHFEVFNFVP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wnb Structures of respiratory syncytial virus G antigen bound to broadly neutralizing antibodies.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		H32 R91 N92 N93 W94 Y95
Binding residue
(residue number reindexed from 1)		H32 R91 N92 N93 W94 Y95
External links