Structure of PDB 5v6l Chain M Binding Site BS01

Receptor Information
>5v6l Chain M (length=215) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALVMTQTPSSVSAAVGGTVTINCQASEDIQRNLAWYQQKPGQRPKFLIYG
VSNLESGVPSRFKGSGSGTEYTLTISDLECDDAATYYCQSALYTSATDIC
AFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVT
WEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVT
QGTTSVVQSFNRGDC
Ligand information
>5v6l Chain Q (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HIGPGRAFYTTGEIIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v6l Increased epitope complexity correlated with antibody affinity maturation and a novel binding mode revealed by structures of rabbit antibodies against the third variable loop (V3) of HIV-1 gp120.
Resolution2.549 Å
Binding residue
(original residue number in PDB)		Q30 Y93 T94 I95D
Binding residue
(residue number reindexed from 1)		Q30 Y93 T94 I99
External links