Structure of PDB 5lqw Chain M Binding Site BS01

Receptor Information
>5lqw Chain M (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDQIAKNVKLDDFIPKELSVPLPTKAEIQECTARTKSYIQRLVNAKLANS
SRYVTETHSHHIEVVSKQMDPLLPRFVGKKARKVVAPTENDEVVPVLHMD
GSNDRGEADPNEWKIPAAVSNWKNPNGNNTINDGFMKLSEALENADKKAR
QEIRSKMELKRLAMEQEML
Ligand information
>5lqw Chain 2 (length=81) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuuca
guguaacaacugaaaugaccucaaugaggcu
...............................................<<<
<<......>>>>>.....<<<<...>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lqw Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
Resolution5.8 Å
Binding residue
(original residue number in PDB)		N176 G177
Binding residue
(residue number reindexed from 1)		N126 G127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lqw, PDBe:5lqw, PDBj:5lqw
PDBsum5lqw
PubMed27562955
UniProtP28004|PRP45_YEAST Pre-mRNA-processing protein 45 (Gene Name=PRP45)

[Back to BioLiP]