Structure of PDB 5lj3 Chain M Binding Site BS01

Receptor Information
>5lj3 Chain M (length=252) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFA
LQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKL
ALRTEALDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLK
PAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQ
TLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMMVH
LI
Ligand information
>5lj3 Chain V (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuu
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj3 Cryo-EM structure of the spliceosome immediately after branching.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		S20 S21 Y34 K36 W37 S38 Q39 R46 F47 C73 L74 F75 M80 C81 C82 Y89 F117 D119 R121 G125 G126 I127 K196 S200 N201 L222 V223
Binding residue
(residue number reindexed from 1)		S18 S19 Y32 K34 W35 S36 Q37 R44 F45 C71 L72 F73 M78 C79 C80 Y87 F115 D117 R119 G123 G124 I125 K194 S198 N199 L220 V221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:0045787 positive regulation of cell cycle
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lj3, PDBe:5lj3, PDBj:5lj3
PDBsum5lj3
PubMed27459055
UniProtQ12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 (Gene Name=CWC2)

[Back to BioLiP]