Structure of PDB 5iya Chain M Binding Site BS01

Receptor Information

>5iya Chain M (length=260) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTRT
MSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRAN
DAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSV
DLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAA
AIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKF
DTPVDKLPQL

Ligand information

>5iya Chain X (length=59) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaagggcgcctataaaagggggtgggggcgcgttcgtcctcagtcgcgat
cgaacactc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5iya Near-atomic resolution visualization of human transcription promoter opening.
Resolution	5.4 Å
Binding residue (original residue number in PDB)	K152 K189 K196 R286 L316
Binding residue (residue number reindexed from 1)	K96 K133 K140 R230 L260

Enzymatic activity

Enzyme Commision number

2.3.1.48: histone acetyltransferase.

Gene Ontology

	Molecular Function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993	RNA polymerase II complex binding
GO:0003677	DNA binding
GO:0004402	histone acetyltransferase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0016407	acetyltransferase activity
GO:0016746	acyltransferase activity
GO:0017025	TBP-class protein binding
GO:0046872	metal ion binding
GO:0046966	nuclear thyroid hormone receptor binding
GO:0061733	peptide-lysine-N-acetyltransferase activity
GO:0140297	DNA-binding transcription factor binding
GO:1990841	promoter-specific chromatin binding

	Biological Process
GO:0001174	transcriptional start site selection at RNA polymerase II promoter
GO:0006338	chromatin remodeling
GO:0006352	DNA-templated transcription initiation
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006473	protein acetylation
GO:0010467	gene expression
GO:0019083	viral transcription
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0051177	meiotic sister chromatid cohesion
GO:0051225	spindle assembly
GO:0051276	chromosome organization
GO:0070897	transcription preinitiation complex assembly
GO:1904798	positive regulation of core promoter binding
GO:1990114	RNA polymerase II core complex assembly

	Cellular Component
GO:0000776	kinetochore
GO:0000793	condensed chromosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005669	transcription factor TFIID complex
GO:0005694	chromosome
GO:0016604	nuclear body
GO:0032153	cell division site
GO:0032993	protein-DNA complex
GO:0042585	germinal vesicle
GO:0090575	RNA polymerase II transcription regulator complex
GO:0097550	transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5iya, PDBe:5iya, PDBj:5iya
PDBsum	5iya
PubMed	27193682
UniProt	Q00403\|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417