Structure of PDB 5dlm Chain M Binding Site BS01

Receptor Information

>5dlm Chain M (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DVLLTQTPLSLPVSLGEQASISCRSSQSIVHSIGDTYLEWYLQKPGQSPK
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFP
YTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNRN

Ligand information

>5dlm Chain Y (length=9) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLLTEVETP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5dlm Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	H31 Y37 E39 F94 Y101
Binding residue (residue number reindexed from 1)	H31 Y37 E39 F94 Y101

External links

PDB	RCSB:5dlm, PDBe:5dlm, PDBj:5dlm
PDBsum	5dlm
PubMed	26468526

[Back to BioLiP]