Structure of PDB 5cxt Chain M Binding Site BS01

Receptor Information
>5cxt Chain M (length=111) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKYS
AQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSM
TATQLLVPSRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cxt UHM-ULM interactions in the RBM39-U2AF65 splicing-factor complex.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
E445 D449 E453 L491 R494 W495 F496 A497 G498 I501 R529
Binding residue
(residue number reindexed from 1)
E26 D30 E34 L72 R75 W76 F77 A78 G79 I82 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5cxt, PDBe:5cxt, PDBj:5cxt
PDBsum5cxt
PubMed27050129
UniProtQ8VH51|RBM39_MOUSE RNA-binding protein 39 (Gene Name=Rbm39)

[Back to BioLiP]