Structure of PDB 4zto Chain M Binding Site BS01

Receptor Information
>4zto Chain M (length=216) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPVLTQTPPSASEPVGGTVTIKCQASQAIDEYLGWYQQKPGQRPKLLMYY
ASTLASGVPSRFKGSGSGTQFTLTISDLECADAATYYCQNYYVGSSTNYA
FTFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTV
TWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKV
TQGTTSVVQSFNRGDC
Ligand information
>4zto Chain Q (length=10) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKAMYAPPIR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zto Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
D30 E31 Y32 Y92 V93 G94 S95
Binding residue
(residue number reindexed from 1)
D30 E31 Y32 Y92 V93 G94 S95
External links