Structure of PDB 4xgz Chain M Binding Site BS01

Receptor Information
>4xgz Chain M (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEVQLVESGGGLVQPGGSLRLSCAASGFNVSYSSIHWVRQAPGKGLEWVA
SIYSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARG
YYGAAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEPKSCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xgz Engineering Synthetic Antibody Inhibitors Specific for LD2 or LD4 Motifs of Paxillin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S33 Y52 Y53 Y54 Y58 Y96 Y97 A99
Binding residue
(residue number reindexed from 1)		S34 Y53 Y55 Y56 Y60 Y101 Y102 A104
External links