Structure of PDB 4ov5 Chain M Binding Site BS01

Receptor Information
>4ov5 Chain M (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
FEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPN
VLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPF
LPSTEDVYDCRVEHWGLDEPLLKHWEFDA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ov5 Susceptibility to HLA-DM Protein Is Determined by a Dynamic Conformation of Major Histocompatibility Complex Class II Molecule Bound with Peptide.
Resolution2.199 Å
Binding residue
(original residue number in PDB)
Q9 A52 S53 F54 G58 A61 N62 N69
Binding residue
(residue number reindexed from 1)
Q6 A49 S50 F51 G55 A58 N59 N66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ov5, PDBe:4ov5, PDBj:4ov5
PDBsum4ov5
PubMed25002586
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]