Structure of PDB 4jo3 Chain M Binding Site BS01

Receptor Information
>4jo3 Chain M (length=214) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQTPASVSAAVGGTVTINCQASETISNYLAWYQQKPGQPPKLLIYK
ASTLASGVSSRFKGSGSGTEYTLTISGVQCDDAATYYCQQGYSISDIDNS
FGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTW
EVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQ
GTTSVVQSFNRGDC
Ligand information
>4jo3 Chain Q (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIIGDIRQA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jo3 Rabbit Anti-HIV-1 Monoclonal Antibodies Raised by Immunization Can Mimic the Antigen-Binding Modes of Antibodies Derived from HIV-1-Infected Humans.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
D1 I2 Y92 S93 S95
Binding residue
(residue number reindexed from 1)
D1 I2 Y92 S93 S95
External links