Structure of PDB 3wuv Chain M Binding Site BS01

Receptor Information
>3wuv Chain M (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEK
KTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wuv Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
Resolution2.79 Å
Binding residue
(original residue number in PDB)
K180 Q183 W184 Y187 Q190 R191 Y194
Binding residue
(residue number reindexed from 1)
K23 Q26 W27 Y30 Q33 R34 Y37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000281 mitotic cytokinesis
GO:0051896 regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process
External links
PDB RCSB:3wuv, PDBe:3wuv, PDBj:3wuv
PDBsum3wuv
PubMed26392564
UniProtQ53EZ4|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]