Structure of PDB 3p6y Chain M Binding Site BS01

Receptor Information

>3p6y Chain M (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGV
LIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQD
GVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKA
LFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLE

Ligand information

>3p6y Chain U (length=4) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugua

....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3p6y Structural basis of pre-mRNA recognition by the human cleavage factor Im complex
Resolution	2.9 Å
Binding residue (original residue number in PDB)	S58 R63 L99 G100 T102 F103 F104 G209
Binding residue (residue number reindexed from 1)	S25 R30 L66 G67 T69 F70 F71 G176

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding

	Biological Process
GO:0031124	mRNA 3'-end processing

	Cellular Component
GO:0005849	mRNA cleavage factor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3p6y, PDBe:3p6y, PDBj:3p6y
PDBsum	3p6y
PubMed
UniProt	O43809\|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 (Gene Name=NUDT21)

[Back to BioLiP]