Structure of PDB 3c2a Chain M Binding Site BS01

Receptor Information
>3c2a Chain M (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIY
GNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADW
VFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT
VAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQV
THEGSTVEKTVAPTEC
Ligand information
>3c2a Chain Q (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIHLGPGRAFYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c2a Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
Resolution2.1 Å
Binding residue
(original residue number in PDB)		W91 A95B W96
Binding residue
(residue number reindexed from 1)		W92 A98 W100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003823 antigen binding
Biological Process
GO:0002250 adaptive immune response
GO:0016064 immunoglobulin mediated immune response
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005886 plasma membrane
GO:0019814 immunoglobulin complex
GO:0070062 extracellular exosome
GO:0071735 IgG immunoglobulin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3c2a, PDBe:3c2a, PDBj:3c2a
PDBsum3c2a
PubMed18566514
UniProtP0DOY2|IGLC2_HUMAN Immunoglobulin lambda constant 2 (Gene Name=IGLC2)

[Back to BioLiP]