Structure of PDB 2z5t Chain M Binding Site BS01

Receptor Information
>2z5t Chain M (length=89) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQR
QHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z5t Molecular basis for the inhibition of p53 by Mdmx.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		M50 G54 I57 Y63 Q68 H69 P92 Y96
Binding residue
(residue number reindexed from 1)		M33 G37 I40 Y46 Q51 H52 P75 Y79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2z5t, PDBe:2z5t, PDBj:2z5t
PDBsum2z5t
PubMed17938582
UniProtQ7ZUW7|MDM4_DANRE Protein Mdm4 (Gene Name=mdm4)

[Back to BioLiP]