Structure of PDB 2y9h Chain M Binding Site BS01

Receptor Information
>2y9h Chain M (length=193) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRL
EPPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANP
AKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGPWVQILQDTFLEV
LQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y9h An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R43 K105 R106 A108 K112 R113 R128 R129 L169 Q170 V171 R194
Binding residue
(residue number reindexed from 1)		R45 K102 R103 A105 K109 R110 R125 R126 L151 Q152 V153 R176
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2y9h, PDBe:2y9h, PDBj:2y9h
PDBsum2y9h
PubMed21572442
UniProtQ53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)

[Back to BioLiP]