Structure of PDB 2bp5 Chain M Binding Site BS01

Receptor Information
>2bp5 Chain M (length=253) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSG
MPECKFGMNDKSIAIDDCTFHQCVRLSERSISFIPPDGEFELMRYRTTKD
IILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSG
VQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWA
RPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYE
TRC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bp5 Non-Canonical Yxxg-Phi Endocytic Motifs: Recognition by Ap2 and Preferential Utilization in P2X4 Receptors.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		F174 D176 Q318 E391 V392 R402 L404 K420 W421 V422 R423
Binding residue
(residue number reindexed from 1)		F16 D18 Q136 E209 V210 R220 L222 K238 W239 V240 R241
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005048 signal sequence binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0035615 clathrin adaptor activity
GO:0044325 transmembrane transporter binding
GO:0050750 low-density lipoprotein particle receptor binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0002092 positive regulation of receptor internalization
GO:0006886 intracellular protein transport
GO:0006897 endocytosis
GO:0006900 vesicle budding from membrane
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0031623 receptor internalization
GO:0048488 synaptic vesicle endocytosis
GO:0065003 protein-containing complex assembly
GO:0072583 clathrin-dependent endocytosis
GO:0097494 regulation of vesicle size
GO:0098884 postsynaptic neurotransmitter receptor internalization
GO:1900244 positive regulation of synaptic vesicle endocytosis
GO:1903077 negative regulation of protein localization to plasma membrane
Cellular Component
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0008021 synaptic vesicle
GO:0030122 AP-2 adaptor complex
GO:0030131 clathrin adaptor complex
GO:0031410 cytoplasmic vesicle
GO:0043195 terminal bouton
GO:0045202 synapse
GO:0098794 postsynapse
GO:0098894 extrinsic component of presynaptic endocytic zone membrane
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bp5, PDBe:2bp5, PDBj:2bp5
PDBsum2bp5
PubMed15985462
UniProtP84092|AP2M1_RAT AP-2 complex subunit mu (Gene Name=Ap2m1)

[Back to BioLiP]