Structure of PDB 1xgy Chain M Binding Site BS01

Receptor Information
>1xgy Chain M (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSNGITYLYWYLQRPGQSPQ
LLIYRMSNLASGVPDRFSGSGSGTDFALRISRVEAEDVGVYYCGQMLEHP
LTFGTGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIN
VKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSTSPIVKSFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xgy Equilibrium between metarhodopsin-I and metarhodopsin-II is dependent on the conformation of the third cytoplasmic loop.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		Y32 Y34 R50 M91 L92 H94 L96
Binding residue
(residue number reindexed from 1)		Y37 Y39 R55 M96 L97 H99 L101
External links