Structure of PDB 1u3e Chain M Binding Site BS01

Receptor Information
>1u3e Chain M (length=174) Species: 10685 (Okubovirus SPO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKG
KTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQ
MSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRG
KVTDVLKGHRIHHKGYTFRYKLNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u3e DNA Binding and Cleavage by the HNH Homing Endonuclease I-HmuI.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		S23 S26 K31 Q33 F45 G48 Q93 K94 V97 L106 V108 Q112 K116 K121 S137 T138 K139 G150 T153 D154 K157 Y170
Binding residue
(residue number reindexed from 1)		S23 S26 K31 Q33 F45 G48 Q93 K94 V97 L106 V108 Q112 K116 K121 S137 T138 K139 G150 T153 D154 K157 Y170
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1u3e, PDBe:1u3e, PDBj:1u3e
PDBsum1u3e
PubMed15313606
UniProtP34081|HMUI_BPSP1 DNA endonuclease I-HmuI

[Back to BioLiP]